PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_45591.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 212aa    MW: 23652 Da    PI: 9.0005
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_45591.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR155.81.5e-1761146291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            +Y++YA++ GF + +++s+ + ++g+ t   + C ++gk+++  kk   + + r+ t+t+Ckak++v  e +g  ++ +++leHnHel
  evm.TU.contig_45591.1  61 YYSKYAQREGFGIMRRSSRCR-EDGKLTYFILACAQSGKTRSIAKK---RFQFRQLTKTNCKAKINVVVEPEGCVHICNVVLEHNHEL 144
                            9*************9987775.9999**************999887...8999*********************************** PP

                   FAR1  90 ap 91 
                            +p
  evm.TU.contig_45591.1 145 SP 146
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.7E-1561146IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
EMESNSNLKV PFDRDAIDSC CNNRVENGKE EEHGAGGLNG DEVGPPCVGM VFASQDEVRS  60
YYSKYAQREG FGIMRRSSRC REDGKLTYFI LACAQSGKTR SIAKKRFQFR QLTKTNCKAK  120
INVVVEPEGC VHICNVVLEH NHELSPGKKQ RNICKRSGTP RNKRKYALEE LVGAPVQLDS  180
RLASRESWAP LNLPSGANYL QFVLLMKCFA S*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307977.21e-62hypothetical protein POPTR_0006s03800g, partial
RefseqXP_011027247.14e-62PREDICTED: probable ribose-5-phosphate isomerase 3, chloroplastic
TrEMBLB9H9321e-62B9H932_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0006s03800.13e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17343310
Representative plantOGRP1037723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-10FAR1 family protein